R
Creative Strategist
Ramen BaeRemoteabout 1 month ago
Full-timeRemoteVia Remote OKexeceducationstrategycustomer supportcopywritingmarketingtravelspeechvideomobilecontent writingseniormedicalsocial mediaecommercefull timedata entrydevweb devmicrosoftopsdigital nomadlegaldesigntechnicalsalesrecruiteradsart directionsaastestingengineerhrsys admincoordinatorpayrollfinanceexceldesignergolang
Apply now About this role
Creative Strategist - Ramen Bae ABOUT RAMEN BAE Ramen Bae is the original dried ramen toppings company on a mission to level up the ramen category. We started three years ago as a passion project because we wanted better instant ramen toppings and couldnât find anything like it. Since then, weâve gone viral, built a loyal fan base, grown to over 400,000 customers, and recently launched protein ramen. Weâre still just getting started. Weâre a small, fast-moving team of builders who take ownership, move quickly, and figure things out as we go. Weâre looking for another like-minded person who is excited to help us build the next great ramen brand. ABOUT THE ROLE Ramen Bae is looking for a Creative Strategist to build and lead the creative engine behind our DTC ramen brand. This person will own performance-driven creative across paid social, with Meta currently being our largest channel. Youâll be responsible for understanding our products, customers, audience awareness stages, and performance data, then turning those insights into ad concepts, hooks, scripts, creator briefs, and video assets that convert. This role sits at the intersection of performance marketing, creative strategy, consumer psychology, and execution. The ideal candidate is analytical enough to understand what is working and why, creative enough to find new angles that break through, and scrappy enough to move quickly from idea to launch. This is a high-impact role with significant room for leadership and growth. Youâll work closely with the CMO and growth team to build a repeatable system for producing high-performing creative at scale. RESPONSIBILITIES Creative Strategy ⢠Own creative strategy across paid social and performance marketing channels, with a strong focus on Meta. ⢠Build and manage a repeatable creative testing framework across hooks, formats, scripts, offers, concepts, personas, and audience segments. ⢠Develop creative angles based on customer pain points, product